47 Comments
User's avatar
Willie Gillie's avatar

I’m thoroughly disgusted by the actions of the medical community these last few years. I’d trust a veterinarian long before I’d trust the kavorkians we have as doctors today. They are certainly quickly becoming the scum of the Earth.

Expand full comment
Nadine A White's avatar

I couldn't agree with you more. I've learned more from You Tube concerning my health than the last 70 years from doctors.

Expand full comment
SaHiB's avatar

Once upon a time, eczema was a contraindication to further vaccination, at least those containing aluminum adjuvant. Wish I had the URL of the graphic to post. While I have no eczema, DTP gave me food (outgrown), pollen, and mold spore allergies, and asthma. Last was likely a comorbidity leading to original CoViD-19 nearly killing me with choking, bronchial spasms. (02 March 2020)

Expand full comment
Mark Manno's avatar

I'm afraid I wouldn't trust Youtube for questions regarding health. Google owns Youtube, and much so-called alternative medicine has been scrubbed from their search engine. Remember that the truth tellers out there were censored by Youtube for four years.

Expand full comment
Willie Gillie's avatar

Agreed

Expand full comment
SaHiB's avatar

Most of them promote unnecessary vaccinations. My dogs' veterinarian, along with his wife (a Vietnam flight nurse) died after doing their civic duty and getting CoViD shots. This, despite their favoring much alternative medicine.

Expand full comment
Ned B.'s avatar

Both husband and wife died after vaccination? Didn't that seem suspicious at least to someone?

Expand full comment
DUANE HAYES's avatar

When RFK fired the big pharma shills, and hired real doctors and scientists, each and every medical organization called for his resignation. So you're right, the medical community sucks and they all are big pharma shills, only in it for the money, and the health of people at the bottom of their list.

Expand full comment
Nadine A White's avatar

My thoughts are that the health of people isn't even in the running. Big Pharma needs us alive but sick of course. Something really sinister has happened to people. How much money is enough?

Expand full comment
mejbcart's avatar

yes, definitely (unjabbed!) animals are being in a better situation than we. You get in pet food store Ivermectin, fenben, DMSO, etc., etc.

Expand full comment
Willie Gillie's avatar

That’s right. Coincidentally Ivermectin used to only be used by humans. They found it so safe they allowed it to be given to pets. Now the pets have it and we don’t. Imagine that. Our leaders do not have our best interests at heart, sad to say.

Expand full comment
Thomas A Braun RPh's avatar

The last FDA Commissioner that had the health interests of the American public as his main goal was Dr. David Kessler before RFK became head of NIH. A lawyer and a physician. He revamped the ADR reporting system in the early 1990's and stated he believe that only about 1% of ADR's are reported. Why would a medical professional report that they injected a child with a RNA injection had killed the child. The 10 is at least 20 times and maybe 100 times. We will never know the true number. It was reported that he revamped the system because of the fall out of the Zomax fiasco that killed about 3600 patients in the early 1980's. Big tobacco did a number on him and used their political clout to force him to resign and become head of Public Health in California. Big Medicine has used many avenues of influence to control the direction of medicine ever since WWII. Our Congressman in DC keep their mouth shut because they know they will be drummed out just like Dr. Kessler. They are trying to do it to RFK through many avenues. Rockefeller set the stage in the early 1900's which today has become an intolerable and costly medical environment costing 5 Trillion annually.

Expand full comment
Motoko's avatar

Thank you, and may God bless you all at the McCullough Foundation

Expand full comment
Lowell's avatar

I immediately said: they’re admitting to 10 so they can say “we’re honest, see? And 10 is minuscule when considering millions of doses given. They’re safe!” Utter BULLSHIT.

Expand full comment
Sukey Watson's avatar

This was a good discussion thank you Dr. Mcullough and Nick H. For calling out the issues surrounding this information. Never give up holding those agencies accountable

Expand full comment
Noelle's avatar

Pfizer, Moderna, J&J and AstraZeneca are responsible!

Expand full comment
Mark Manno's avatar

Yes, they're responsible. However, remember that the Covid response was and IS essentially a military operation, NOT a health response. If you need to know more about this truth, check out Sasha Latypova's Substack for detailed analysis.

Expand full comment
Mary Renaud's avatar

Ed Dowd wrote a book, Cause Unknown, (2021- 1st Ed.) citing death after death of strong athletes from adolescent ages and young adult years, all vaccinated with the CV19 jabs, who suddenly died after high exertion in a sport. Heart issues, particularly myocarditis was implicated. The HEALTHIEST and STRONGEST among us dropped dead after an untested CV 19 mRNA vaccination. This is horrifying.

The later versions of the book 2022, and 2023, have updated data.

Recall that the CDC/NIH crowd changed the definition of ‘vaccinated’ for the CV19 mRNA vaccine/bioweapon jab, to only those who received both the complete 2 series of shots, plus 2 weeks after the final shot. If you dropped dead within hours or days of your toxic injections, you were considered Unvaccinated if it was BEFORE this extended timeframe, thus lying about the mounting body count all over the globe from these horrific poisons.

These are Crimes against Humanity and yet our worthless government regulators STILL have not banned all mRNA injections for all age groups!

The CV19 vaccine was found to have Contaminated vials, toxic ingredients including brain penetrating LNP’s, graphene, the SV40 cancer causing agent, animal and human DNA, mRNA gene editing components, and the Spike Protein as the antigen, it was and is nothing less than a dangerous toxic bomb to human beings.

Famed virologist Dr Luc Montagnier winner of the Nobel in Medicine in 2008, along with others, for discovery of the HIV virus, stated in 2021 that the selection of the Spike Protein (SP)for the CV19 vaccine Antigen was a fundamental ERROR, as this is the most toxic part of the virus. He pointed out that the SP has homology (similarity) to natural human proteins and this could trigger auto immune disease, when the immune system attacks the body’s own cells. He was very concerned about neurological issues with LNP penetration of the blood brain barrier, well known in the research literature.

Dr Montagnier was gaslit, called an out of date has-been, accused of being ‘behind in modern research’ and worse. His voice was silenced except in some remote areas of the internet, and difficult to locate. Instead of a Nobel winning virologist, still quite lucid in his late 80’s, we were told to listen to the lying Dr Fauci, Dr Sanjay Gupta and other ‘TV MD’ spokespersons, none of who had a Nobel in anything and several of whom received big money from Pharma, directly or indirectly.

Dr Montagnier died in February 2022 at 89 years of age. You can find his videos during the pandemic on Rumble (in French, English subtitles). Watch as many as you can. Everything this wonderful man told us was and IS STILL true.

The Pfizer reports to the FDA included an estimated 1200+ deaths IN THE FIRST 90 DAYS of the CV19 mRNA rollout (see the book. The Pfizer Documents Analysis Reports (on what Pfizer reported to FDA and FDA wanted to HIDE FROM US FOR 75 years).

There are no significant reports of excess deaths in 2020. Excess Mortality has risen in EVERY heavily vaccinated country starting in 2021.

Was it all really just about billions upon billions of dollars, or is it in fact much more sinister, an effort to carry out long term genocide against the majority of humanity? Many believe, with good reason it is the latter.

THEY WANT US DEAD!

DO NOT COMPLY!

Pray to God for the Truth to continue to come out and for those responsible to pay the price for their lies and their actions.

Expand full comment
mejbcart's avatar

Sorry to say, BUT It is NOT ONLY the jabbed who have huge issues, the shedded upon are equally in danger! An elderly friend of mine, covid uninjected married somebody who had 4 covid shots! After ~2 years, that person's ferritin level is ONE (1 !!), has difficulty breathing and can't do extensive jobs, including walking! Pneumonia for ~ 1month... Why is that? Here BLAST (NIH software) BIOINFORMATICS result comparing the amino acid sequence of the Spike with ferritin, 33% IDENTITIES!!!!:

Query 82 FLQDIKKPDCDDWE-SGLNAMECALHLE--------KNVNQSLLEF 118 Ferritin

+ ++ PD D + SG+NA + E KN+N+SL++

Sbjct 1155 YFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL 1200 Spike2020

Query 13 YHQDSEAAINRQINLELYA---SYVYLSMSYYFDRD----------DVALKNFAKYF 56

YH+++++ + + + A ++ Y+S + D + + KN YF

Sbjct 145 YHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYF 201

shifted fragment:

Query 45 DDVALKN-FAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPD 90

+D+ N +A F+ + E R+ A + G+I + K PD

Sbjct 388 NDLCFTNVYADSFVIRGDEVRQIAPG-------QTGKIADYNYKLPD 427

Query 118 FPSPISPS 125 Ferritin

P P PS

Sbjct 806 LPDPSKPS 813 Spike2020

sorry for the formatting, that's the editor..

This is literally CRAZY to think that scientists would INTENTIONALLY take one of the most important proteins in human body, combine it with TOXIC VIRAL LOAD of all possible viruses, called it SARS-CoV-2 Spike AND then applied that synthetics into BILLIONS of HUMAN ARMS under the falsified name of 'vaccines'. Was it in order to KILL everybody?!!!!

So AFTER genetically MODIFYING HUMANS, we see now the following, form GenoneWeb:

""Following careful evaluation by the New York State Department of Health, we are delighted to receive … approval to commercially promote Cardio InCode-Score for genetic risk prediction of heart disease in New York state," GeninCode CEO Matthew Walls said in a statement. "

All THEY WANT IS YOUR GENES, the ones which THEY OVERWROTE with covid shots and now apparently can fix!!! REALLY?

Indeed, look what Sam Altman, now wants to add a bit to the LOST human lives, quote:

"The team behind Retro Bio, a longevity startup backed by OpenAI CEO Sam Altman, is close to raising what could be one of the drug industry’s largest investment rounds. And although the company doesn’t have any clinical data in hand yet, it is chasing a $5 billion valuation.

Retro Bio is a quiet company with large ambitions: The team wants to use a mixture of epigenetic editing, cell replacement therapies, and other approaches to spur younger, healthier cells into aging tissues. The goal is to add 10 years to the human lifespan. "

Expand full comment
sandy's avatar

Thank you and God Bless you, Nicholas and Dr. McCullough for your honest, fearless assessment and work. Limited Hangout by FDA seems a good call.

Expand full comment
Ionedery2's avatar

It's pretty clear from your conversation that the regulatory agencies are too far gone to do the job they're paid to do, and that the corruption is deep and goes all the way to the top. The taxpaid system is now not just failing their duty and purpose, but also continually perpetuating harm. Harm to countless recipients of dangerous and deadly products and harm to the whole healthcare industry. They betrayed our trust and it's too late to say "I'm sorry".

We're on our own now in this brave new world.

Expand full comment
James Wobschall's avatar

Thanks for all you are doing to try to put an end to the continuation of this national nightmare.

The fact that these mRNA shots have killed millions world wide and injured millions in the United States is no secret. From President Trump on down through the HHS agencies, there is no believable reason they could possibly provide that would convince me that they just didn’t know. Their actions and inactions in this matter have been and are nothing short of criminal.

There must be something much bigger than we all realize going on that causes them to act criminally.

Pam Bondi and Kash Patel, where are you?

Just my opinion.

Expand full comment
evergreen's avatar

Bondi, Kash?

Not performing the nation's most needed work, that much is apparent.

Expand full comment
Allie's avatar

A JAMANetwork Pediatrics article today suggests giving COVID shots off-label. They are doing everything they can to push these gene transfer products on infants and young children. They would consider this posting misinformation. They are a despicable evil group.

Expand full comment
mejbcart's avatar

Why on earth only Pfizer??? Only because of Bourla appearance in WH? Moderna shots are equally responsible for deaths, in particular for the younger ages, they are comparable..

Here VAERS (https://www.medalerts.org/vaersdb/index.php) run in expert mode:

MODERNA:

age DEATH count Percent

1-2 Years 7 0.06%

3-5 Years 1 0.01%

6-17 Years 29 0.25%

18-29 Years 189 1.66%

PFIZER:

< 6 Months 2 0.01%

6-11 Months 2 0.01%

1-2 Years 4 0.02%

3-5 Years 4 0.02%

6-17 Years 156 0.64%

18-29 Years 226 0.92%

these numbers of course DEPEND ON THE TOTAL AMOUNT OF ADMINISTERED JABS and normalization to that number, not just total amount of deaths from UNKNOWN number of administered jabs...

With that, the 2 total reports for Pfizer AND Mod-E-RNA:

1. Found 11,378 cases where Vaccine is COVID19 or COVID19-2 and Manufacturer is MODERNA and Patient Died

2. Found 24,481 cases where Vaccine is COVID19 or COVID19-2 and Manufacturer is PFIZER/BIONTECH and Patient Died

Btw. WHY NOT MODERNA reporting?? Because Mod-E-RNA shots for adults for example, had 3x MORE CONCENTRATED amount of the synthetic genetic material, which means, the here presented results 'suggest', that MORE modmRNA is 'SAFER'!! An astronomical LIE allowing to continue with the gene therapies crimes. Just my opinion.

Expand full comment
Dag Waddell's avatar

If it wasn’t obvious at the start it should be by now that there is no way that this is how public health would be managed. The outcomes have been too bad for them to not have changed course. Whatever is being achieved, it’s not a public health objective.

Expand full comment
bagel with a schmear's avatar

Achieved is the key word here. Many are calling it a depopulation agenda.

Expand full comment
mejbcart's avatar

also good point of view:

https://sashalatypova.substack.com/p/10

The title has in its first version 'Microscopic' word, which now disappeared, and which I'd suggest to change to NANOSCOPIC, given the BIRTH RATES and PREGNANCIES ISSUES!!!

Expand full comment
Alexandra Jones's avatar

Thank you both so much Dr. Peter McCullough and Nicolas Hulscher for your relentless extraordinary work. You have discussed this disturbing FDA leaked update with clarity and we need to share it globally. The Trump administration and political leaders in all heavily “vaccinated” countries can’t afford to ignore the mounting evidence of post vaccination injury and unprecedented deaths.

They must represent the public interest and immediately suspend the ongoing administration of dodgy and deadly Covid-19 injections. They must also urgently review all registered, approved, authorised or mandated “vaccines” for children. 🙏🙏

Expand full comment
Brandon is not your bro's avatar

…. And the ACOG still wants every pregnant woman jabbed 🤬

Expand full comment